PDB entry 1tmq

View 1tmq on RCSB PDB site
Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Deposited on 1998-01-13, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmqA (A:)
    ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
    qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
    pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
    gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
    cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
    npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
    ehrwrqvygmvgfrnavegtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglp
    agtycdvisgelsggsctgksvtvgdngsadislgsaeddgvlaihvnakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmqB (B:)
    svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
    rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsl