PDB entry 1tmq

View 1tmq on RCSB PDB site
Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: alpha-amylase, carbohydrate metabolism, alpha-1, 4-glucan-4-glucanohydrolase, hydrolase bifunctional alpha-amylase/trypsin inhibitor, complex (enzyme/ inhibitor), hydrolase/hydrolase inhibitor complex
Deposited on 1998-01-13, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase)
    Species: Tenebrio molitor [TaxId:7067]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56634 (0-470)
      • modified residue (0)
    Domains in SCOPe 2.07: d1tmqa1, d1tmqa2
  • Chain 'B':
    Compound: protein (ragi bifunctional inhibitor)
    Species: Eleusine coracana [TaxId:4511]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01087 (0-116)
      • conflict (69)
    Domains in SCOPe 2.07: d1tmqb_
  • Heterogens: CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmqA (A:)
    ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
    qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
    pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
    gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
    cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
    npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
    ehrwrqvygmvgfrnavegtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglp
    agtycdvisgelsggsctgksvtvgdngsadislgsaeddgvlaihvnakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmqB (B:)
    svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
    rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsl