PDB entry 1tmo

View 1tmo on RCSB PDB site
Description: trimethylamine n-oxide reductase from shewanella massilia
Class: oxidoreductase
Keywords: oxidoreductase, tmao reductase, oxotransferase, molybdoenzyme, mo-cofactor, molybdenum, bis (molybdopterin guanine dinucleotide)
Deposited on 1998-08-03, released 1999-03-30
The last revision prior to the SCOP 1.73 freeze date was dated 1999-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trimethylamine n-oxide reductase
    Species: Shewanella massilia
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tmoa1, d1tmoa2
  • Heterogens: 2MD, 2MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tmoA (A:)
    mnrrdflkgiasssfvvlggssvltplnalakaginedewlttgshfgafkmkrkngvia
    evkpfdldkyptdmingirgmvynpsrvrypmvrldfllkghksnthqrgdfrfvrvtwd
    kaltlfkhsldevqtqygpsglhagqtgwratgqlhsstshmqravgmhgnyvkkigdys
    tgagqtilpyvlgstevyaqgtswplilehsdtivlwsndpyknlqvgwnaethesfayl
    aqlkekvkqgkirvisidpvvtktqaylgceqlyvnpqtdvtlmlaiahemiskklyddk
    fiqgyslgfeefvpyvmgtkdgvaktpewaapicgveahvirdlaktlvkgrtqfmmgwc
    iqrqqhgeqpywmaavlatmigqiglpgggisyghhyssigvpssgaaapgafprnlden
    qkplfdssdfkgasstipvarwidailepgktidangskvvypdikmmifsgnnpwnhhq
    drnrmkqafhklecvvtvdvnwtatcrfsdivlpacttyerndidvygayanrgilamqk
    mveplfdslsdfeiftrfaavlgkekeytrnmgemewletlyneckaanagkfempdfat
    fwkqgyvhfgdgevwtrhadfrndpeinplgtpsglieifsrkidqfgyddckghptwme
    ktershggpgsdkhpiwlqschpdkrlhsqmcesreyretyavngrepvyispvdakarg
    ikdgdivrvfndrgqllagavvsdnfpkgivrihegawygpvgkdgsteggaevgalcsy
    gdpntltldigtsklaqacsaytclvefekyqgkvpkvssfdgpievei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tmoA (A:)
    nedewlttgshfgafkmkrkngviaevkpfdldkyptdmingirgmvynpsrvrypmvrl
    dfllkghksnthqrgdfrfvrvtwdkaltlfkhsldevqtqygpsglhagqtgwratgql
    hsstshmqravgmhgnyvkkigdystgagqtilpyvlgstevyaqgtswplilehsdtiv
    lwsndpyknlqvgwnaethesfaylaqlkekvkqgkirvisidpvvtktqaylgceqlyv
    npqtdvtlmlaiahemiskklyddkfiqgyslgfeefvpyvmgtkdgvaktpewaapicg
    veahvirdlaktlvkgrtqfmmgwciqrqqhgeqpywmaavlatmigqiglpgggisygh
    hyssigvpssgaaapgafprnldenqkplfdssdfkgasstipvarwidailepgktida
    ngskvvypdikmmifsgnnpwnhhqdrnrmkqafhklecvvtvdvnwtatcrfsdivlpa
    cttyerndidvygayanrgilamqkmveplfdslsdfeiftrfaavlgkekeytrnmgem
    ewletlyneckaanagkfempdfatfwkqgyvhfgdgevwtrhadfrndpeinplgtpsg
    lieifsrkidqfgyddckghptwmektershggpgsdkhpiwlqschpdkrlhsqmcesr
    eyretyavngrepvyispvdakargikdgdivrvfndrgqllagavvsdnfpkgivrihe
    gawygpvgkdgsteggaevgalcsygdpntltldigtsklaqacsaytclvefekyqgkv
    pkvssfdgpievei