PDB entry 1tml

View 1tml on RCSB PDB site
Description: crystal structure of the catalytic domain of a thermophilic endocellulase
Class: beta-amylase
Keywords: beta-amylase, endocellulase,catalytic domain
Deposited on 1993-06-08, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2000-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-d-glucanase
    Species: THERMOMONOSPORA FUSCA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tmla_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmlA (A:)
    ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
    aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
    lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
    ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
    tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa