PDB entry 1tml

View 1tml on RCSB PDB site
Description: crystal structure of the catalytic domain of a thermophilic endocellulase
Deposited on 1993-06-08, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tml__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tml_ (-)
    ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
    aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
    lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
    ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
    tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa