PDB entry 1tmk

View 1tmk on RCSB PDB site
Description: yeast thymidylate kinase complexed with thymidine monophosphate (dtmp)
Class: phosphotransferase
Keywords: transferase (phosphotransferase), kinase, thymidine activation pathway, enzyme
Deposited on 1997-06-12, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Gene: CDC8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tmka_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Gene: CDC8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tmkb_
  • Heterogens: SO4, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tmkA (A:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tmkA (A:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
    ealiwqivepvlsthidhdkfsff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tmkB (B:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tmkB (B:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
    ealiwqivepvlsthidhdkfsff