PDB entry 1tmj

View 1tmj on RCSB PDB site
Description: Crystal structure of E.coli apo-HPPK(W89A) at 1.45 Angstrom resolution
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, 6-hydroxymethylpterin, 6-hydroxymethyl-7,8-dihydropterin, antimicrobial agent, drug design, x-ray crystallography, point mutant, structural mutagenesis, transferase
Deposited on 2004-06-10, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.155
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  Species: Escherichia coli [TaxId:562]
  Gene: FOLK, B0142
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (88)
  Domains in SCOPe 2.08: d1tmja_
• Heterogens: MG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tmjA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaeragprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw