PDB entry 1tmh

View 1tmh on RCSB PDB site
Description: modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-03-22, released 1994-06-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.166
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A858 (0-253)
      • engineered (224)
      • engineered (226)
      • engineered (229)
      • engineered (238)
      • engineered (239)
      • engineered (241-242)
      • engineered (244-245)
    Domains in SCOPe 2.01: d1tmha_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A858 (0-253)
      • engineered (224)
      • engineered (226)
      • engineered (229)
      • engineered (238)
      • engineered (239)
      • engineered (241-242)
      • engineered (244-245)
    Domains in SCOPe 2.01: d1tmhb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A858 (0-253)
      • engineered (224)
      • engineered (226)
      • engineered (229)
      • engineered (238)
      • engineered (239)
      • engineered (241-242)
      • engineered (244-245)
    Domains in SCOPe 2.01: d1tmhc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A858 (0-253)
      • engineered (224)
      • engineered (226)
      • engineered (229)
      • engineered (238)
      • engineered (239)
      • engineered (241-242)
      • engineered (244-245)
    Domains in SCOPe 2.01: d1tmhd_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmhA (A:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
    fvdiinaaeaakqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmhB (B:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
    fvdiinaaeaakqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmhC (C:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
    fvdiinaaeaakqa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tmhD (D:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqhdvdgflvggaslkpe
    fvdiinaaeaakqa