PDB entry 1tm9

View 1tm9 on RCSB PDB site
Description: NMR Structure of gene target number gi3844938 from Mycoplasma genitalium: Berkeley Structural Genomics Center
Class: Structural genomics, unknown function
Keywords: all alpha helical protein, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, unknown function
Deposited on 2004-06-10, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein MG354
    Species: Mycoplasma genitalium [TaxId:2097]
    Gene: MG354
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tm9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tm9A (A:)
    meqnnikeqlisffnqacsthqerldficstresdtfssvdvplepikniieitkdenqq
    ieitkiavnniktlssvgatgqymasffstnsepaiifcviyflyhfgflkdnnkkqiik
    kayetiadniadylnen