PDB entry 1tm0

View 1tm0 on RCSB PDB site
Description: Crystal Structure of the putative proline racemase from Brucella melitensis, Northeast Structural Genomics Target LR31
Class: isomerase
Keywords: STRUCTURAL GENOMICS, alpha-beta protein that resembles double-beta barrel, in each of which an alpha helix is sandwiched, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ISOMERASE
Deposited on 2004-06-10, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline racemase
    Species: Brucella melitensis [TaxId:224914]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFD6 (0-End)
      • modified residue (0)
      • modified residue (75)
      • modified residue (80)
      • modified residue (88)
      • modified residue (108)
      • modified residue (115)
      • modified residue (163)
      • modified residue (262)
      • modified residue (271)
      • modified residue (320)
    Domains in SCOPe 2.06: d1tm0a_
  • Chain 'B':
    Compound: proline racemase
    Species: Brucella melitensis [TaxId:224914]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFD6 (0-End)
      • modified residue (0)
      • modified residue (75)
      • modified residue (80)
      • modified residue (88)
      • modified residue (108)
      • modified residue (115)
      • modified residue (163)
      • modified residue (262)
      • modified residue (271)
      • modified residue (320)
    Domains in SCOPe 2.06: d1tm0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tm0A (A:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
    ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
    kpaispiisgrawvtgtsqlmldpsdpfphgyrlsdtwprdelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tm0A (A:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
    sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
    ldpsdpfphgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tm0B (B:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
    ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
    kpaispiisgrawvtgtsqlmldpsdpfphgyrlsdtwprdelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tm0B (B:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
    sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
    ldpsdpfphgy