PDB entry 1tm0

View 1tm0 on RCSB PDB site
Description: crystal structure of the putative proline racemase from brucella melitensis, northeast structural genomics target lr31
Deposited on 2004-06-10, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tm0a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tm0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tm0A (A:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
    ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
    kpaispiisgrawvtgtsqlmldpsdpfphgyrlsdtwprdelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tm0A (A:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
    sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
    ldpsdpfphgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tm0B (B:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigmkiepgqarelaeigvkitkaaneqlgfrhperdwrhisfcqitepvtregdvltgv
    ntvairpakfdrsptgtgcsarmavlhakgqmkagerfigksvlgtefhcrldkvlelgg
    kpaispiisgrawvtgtsqlmldpsdpfphgyrlsdtwprdelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tm0B (B:)
    mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvf
    rhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvlea
    pggiieveaecrngkaerisvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaa
    qigepgqarelaeigvkitkafrhperdwrhisfcqitepvtregdvltgvntvptgtgc
    sarmavlhakgqmkagerfigksvtefhcrldkvlelggkpaispiisgrawvtgtsqlm
    ldpsdpfphgy