PDB entry 1tlw

View 1tlw on RCSB PDB site
Description: Tsx structure complexed with thymidine
Class: membrane protein
Keywords: nucleoside transporter, BETA BARREL, thymidine, MEMBRANE PROTEIN
Deposited on 2004-06-10, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.269
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside-specific channel-forming protein tsx
    Species: Escherichia coli [TaxId:562]
    Gene: TSX, NUPA, B0411, Z0512, ECS0464, SF0348, S0356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A927 (Start-271)
      • expression tag (272-274)
    Domains in SCOPe 2.07: d1tlwa1, d1tlwa2
  • Chain 'B':
    Compound: Nucleoside-specific channel-forming protein tsx
    Species: Escherichia coli [TaxId:562]
    Gene: TSX, NUPA, B0411, Z0512, ECS0464, SF0348, S0356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlwb_
  • Heterogens: THM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlwA (A:)
    aendkpqylsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvff
    ggnsdakgiwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrq
    stwymglgtdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggq
    lsyigftnfdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdgg
    qwnddaelnfgngnfnvrstgwggylvvgynfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlwA (A:)
    lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf
    sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy
    akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain
    giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg
    ylvvgynfhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tlwB (B:)
    aendkpqylsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvff
    ggnsdakgiwnhgsplfmeieprfsidkltntdlsfgpfkewyfannyiydmgrnkdgrq
    stwymglgtdidtglpmslsmnvyakyqwqnygaanenewdgyrfkikyfvpitdlwggq
    lsyigftnfdwgsdlgddsgnaingiktrtnnsiasshilalnydhwhysvvarywhdgg
    qwnddaelnfgngnfnvrstgwggylvvgynfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlwB (B:)
    lsdwwhqsvnvvgsyhtrfgpqirndtyleyeafakkdwfdfygyadapvplfmeieprf
    sidkltntdlsfgpfkewyfannyiydmgrnkdgrqstwymglgtdidtglpmslsmnvy
    akyqwqnygaanenewdgyrfkikyfvpitdlwggqlsyigftnfdwgsdlgddsgnain
    giktrtnnsiasshilalnydhwhysvvarywhdggqwnddaelnfgngnfnvrstgwgg
    ylvvgynf