PDB entry 1tlv

View 1tlv on RCSB PDB site
Description: Structure of the native and inactive LicT PRD from B. subtilis
Class: transcription
Keywords: transcriptional antitermination, conformational change, LicT, histidine phosphorylation, activation mechanism, HPr, dimer structure, phosphoenolpyruvate (PEP): sugar phosphotransferase system (PTS), PTS regulation domains (PRD), TRANSCRIPTION
Deposited on 2004-06-10, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.269
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription antiterminator lict
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LICT, N15A, BSU39080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39805 (3-220)
      • cloning artifact (0-2)
      • modified residue (16)
    Domains in SCOPe 2.08: d1tlva1, d1tlva2, d1tlva3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlvA (A:)
    gamekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgld
    iknallwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelneempnii
    nitkvmqeilsivkyhfkiefneeslhyyrfvthlkffaqrlfngthmesqddflldtvk
    ekyhrayectkkiqtyiereyehkltsdellyltihiervv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlvA (A:)
    gamekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgld
    iknallwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelneempnii
    nitkvmqeilsivkyhfkiefnslhyyrfvthlkffaqrlfngthmyhrayectkkiqty
    iereyehkltsdellyltihiervv