PDB entry 1tlt

View 1tlt on RCSB PDB site
Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
Deposited on 2004-06-09, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tltA (A:)
    mslkklrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadsls
    slaascdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlm
    vgfnrrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsgg
    kasldggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdm
    rewreergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivd
    kiwrdamseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tltA (A:)
    klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa
    scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn
    rrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasl
    dggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewr
    eergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwr
    dams
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tltB (B:)
    mslkklrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadsls
    slaascdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlm
    vgfnrrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsgg
    kasldggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdm
    rewreergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivd
    kiwrdamseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tltB (B:)
    klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa
    scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn
    rrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasl
    dggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewr
    eergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwr
    damse