PDB entry 1tlt

View 1tlt on RCSB PDB site
Description: Crystal Structure of a Putative Oxidoreductase (VIRULENCE FACTOR mviM HOMOLOG)
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, NYSGXRC, T1535, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-06-09, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)
    Species: Escherichia coli [TaxId:562]
    Gene: MVIM, B1068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlta1, d1tlta2
  • Chain 'B':
    Compound: PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)
    Species: Escherichia coli [TaxId:562]
    Gene: MVIM, B1068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tltb1, d1tltb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tltA (A:)
    mslkklrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadsls
    slaascdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlm
    vgfnrrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsgg
    kasldggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdm
    rewreergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivd
    kiwrdamseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tltA (A:)
    klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa
    scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn
    rrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasl
    dggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewr
    eergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwr
    dams
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tltB (B:)
    mslkklrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadsls
    slaascdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlm
    vgfnrrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsgg
    kasldggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdm
    rewreergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivd
    kiwrdamseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tltB (B:)
    klrigvvglggiaqkawlpvlaaasdwtlqgawsptrakalpiceswripyadslsslaa
    scdavfvhsstashfdvvstllnagvhvcvdkplaenlrdaerlvelaarkkltlmvgfn
    rrfaplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasl
    dggtlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewr
    eergqgvvhkpipgwqstleqrgfvgcarhfiecvqnqtvpqtageqavlaqrivdkiwr
    damse