PDB entry 1tlq

View 1tlq on RCSB PDB site
Description: Crystal structure of protein ypjQ from Bacillus subtilis, Pfam DUF64
Deposited on 2004-06-09, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tlqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlqA (A:)
    mslkkytmnemvditkdmlnkrgvmiediarivqklqekynpnlplsvcmenvekvlnkr
    eiihavltglaldqlaeqkllpeplqhlvetdeplygideiiplsivnvygsigltnfgy
    ldkekigiikeldespdgihtflddivaalaaaaasriahthqdlqdeekeqdekpvvse
    ggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlqA (A:)
    ytmnemvditkdmlnkrgvmiediarivqklqekynpnlplsvcmenvekvlnkreiiha
    vltglaldqlaeqkllpeplqhlvetdeplygideiiplsivnvygsigltnfgyldkek
    igiikeldespdgihtflddivaalaaaaasriahthqdlq