PDB entry 1tlm

View 1tlm on RCSB PDB site
Description: structural aspects of inotropic bipyridine binding: crystal structure determination to 1.9 angstroms of the human serum transthyretin-milrinone complex
Class: transport(thyroxine)
Keywords: transport(thyroxine)
Deposited on 1992-12-22, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tlma_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tlmb_
  • Heterogens: MIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlmA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlmA (A:)
    tgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqf
    vegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    pke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tlmB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlmB (B:)
    skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke