PDB entry 1tll

View 1tll on RCSB PDB site
Description: crystal structure of rat neuronal nitric-oxide synthase reductase module at 2.3 a resolution.
Class: oxidoreductase
Keywords: nitric-oxide synthase, reductase module, fmn, fad, nadp+, oxidoreductase
Deposited on 2004-06-09, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.244
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric-oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476
      • see remark 999 (266)
    Domains in SCOPe 2.07: d1tlla1, d1tlla2, d1tlla3
  • Chain 'B':
    Compound: Nitric-oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476
      • see remark 999 (266)
    Domains in SCOPe 2.07: d1tllb1, d1tllb2, d1tllb3
  • Heterogens: SO3, FMN, FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tllA (A:)
    aklmgqamakrvkatilyatetgksqayaktlceifkhafdakamsmeeydivhleheal
    vlvvtstfgngdppengekfgcalmemrhpnsvqeerksykvrfnsvssysdsrkssgdg
    pdlrdnfestgplanvrfsvfglgsrayphfcafghavdtlleelggerilkmregdelc
    gqeeafrtwakkvfkaacdvfcvgddvniekpnnslisndrswkrnkfrltyvaeapdlt
    qglsnvhkkrvsaarllsrqnlqspkssrstifvrlhtngnqelqyqpgdhlgvfpgnhe
    dlvnalierledappanhvvkvemleerntalgvisnwkdesrlppctifqafkyyldit
    tpptplqlqqfaslatnekekqrllvlskglqeyeewkwgknptmvevleefpsiqmpat
    llltqlsllqpryysissspdmypdevhltvaivsyhtrdgegpvhhgvcsswlnriqad
    dvvpcfvrgapsfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvf
    gcrqskidhiyreetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralke
    qgghiyvcgdvtmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgvtlrt
    yevtnrlrsesiafieeskkdadevfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tllA (A:)
    akrvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstf
    gngdppengekfgcalmemrheerksykvrfnsvsgplanvrfsvfglgsrayphfcafg
    havdtlleelggerilkmregdelcgqeeafrtwakkvfkaacdvfcvgddvniesndrs
    wkrnkfrltyvaeapdltqglsnvhkkrvsaarllsrqnlqspkssrstifvrlhtngnq
    elqyqpgdhlgvfpgnhedlvnalierledappanhvvkvemleerntalgvisnwkdes
    rlppctifqafkyyldittpptplqlqqfaslatnekekqrllvlskglqeyeewkwgkn
    ptmvevleefpsiqmpatllltqlsllqpryysissspdmypdevhltvaivsyhtrdge
    gpvhhgvcsswlnriqaddvvpcfvrgapsfhlprnpqvpcilvgpgtgiapfrsfwqqr
    qfdiqhkgmnpcpmvlvfgcrqskidhiyreetlqaknkgvfrelytaysrepdrpkkyv
    qdvlqeqlaesvyralkeqgghiyvcgdvtmaadvlkaiqrimtqqgklseedagvfisr
    lrddnryhedifgvtlrtyevtnrlrsesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tllB (B:)
    aklmgqamakrvkatilyatetgksqayaktlceifkhafdakamsmeeydivhleheal
    vlvvtstfgngdppengekfgcalmemrhpnsvqeerksykvrfnsvssysdsrkssgdg
    pdlrdnfestgplanvrfsvfglgsrayphfcafghavdtlleelggerilkmregdelc
    gqeeafrtwakkvfkaacdvfcvgddvniekpnnslisndrswkrnkfrltyvaeapdlt
    qglsnvhkkrvsaarllsrqnlqspkssrstifvrlhtngnqelqyqpgdhlgvfpgnhe
    dlvnalierledappanhvvkvemleerntalgvisnwkdesrlppctifqafkyyldit
    tpptplqlqqfaslatnekekqrllvlskglqeyeewkwgknptmvevleefpsiqmpat
    llltqlsllqpryysissspdmypdevhltvaivsyhtrdgegpvhhgvcsswlnriqad
    dvvpcfvrgapsfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpmvlvf
    gcrqskidhiyreetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyralke
    qgghiyvcgdvtmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgvtlrt
    yevtnrlrsesiafieeskkdadevfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tllB (B:)
    rvkatilyatetgksqayaktlceifkhafdakamsmeeydivhlehealvlvvtstfgn
    gdppengekfgcalmemrsykvrfnvrfsvfglgsrayphfcafghavdtlleelggeri
    lkmregdelcgqeeafrtwakkvfkaacdvfcvgddvnieksndrswkrnkfrltyvaea
    pdltqglsnvhkkrvsaarllsrqnlqspkssrstifvrlhtngnqelqyqpgdhlgvfp
    gnhedlvnalierledappanhvvkvemleerntalgvisnwkdesrlppctifqafkyy
    ldittpptplqlqqfaslatnekekqrllvlskglqeyeewkwgknptmvevleefpsiq
    mpatllltqlsllqpryysissspdmypdevhltvaivsyhtrdgegpvhhgvcsswlnr
    iqaddvvpcfvrgapsfhlprnpqvpcilvgpgtgiapfrsfwqqrqfdiqhkgmnpcpm
    vlvfgcrqskidhiyreetlqaknkgvfrelytaysrepdrpkkyvqdvlqeqlaesvyr
    alkeqgghiyvcgdvtmaadvlkaiqrimtqqgklseedagvfisrlrddnryhedifgv
    tlrtyevtnrlrsesi