PDB entry 1tlk

View 1tlk on RCSB PDB site
Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution
Class: calmodulin-binding
Keywords: calmodulin-binding
Deposited on 1992-07-20, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telokin
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1tlka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlkA (A:)
    isgmsgrkasgssptspinankvenedafleevaeekphvkpyftktildmdvvegsaar
    fdckvegypdpevmwfkddnpvkesrhfqidydeegncsltisevcgdddakytckavns
    lgeatctaellvetmgkegegegegeedeeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlkA (A:)
    vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
    deegncsltisevcgdddakytckavnslgeatctaellvetm