PDB entry 1tlk

View 1tlk on RCSB PDB site
Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution
Deposited on 1992-07-20, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1tlk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tlk_ (-)
  vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
  deegncsltisevcgdddakytckavnslgeatctaellvetm