PDB entry 1tlh

View 1tlh on RCSB PDB site
Description: T4 AsiA bound to sigma70 region 4
Class: transcription
Keywords: anti-sigma, sigma70, rna polymerase, TRANSCRIPTION
Deposited on 2004-06-09, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 KDA Anti-Sigma Factor
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tlha_
  • Chain 'B':
    Compound: RNA polymerase sigma factor rpoD
    Species: Escherichia coli [TaxId:562]
    Gene: RPOD, ALT, B3067
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tlhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlhA (A:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlhA (A:)
    nknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivsel
    tqedkktlidefnegfegvyrylemytnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tlhB (B:)
    dsatteslraathdvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqiea
    kalrklrhpsrsevlrsfldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlhB (B:)
    dvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqieakalrklrhpsrse
    vlrsfldd