PDB entry 1tlf

View 1tlf on RCSB PDB site
Description: unprecedented quaternary structure of e. coli lac repressor core tetramer: implications for DNA looping
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1995-03-06, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlfa_
  • Chain 'B':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlfb_
  • Chain 'C':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlfc_
  • Chain 'D':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tlfd_
  • Heterogens: EMC, IPT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tlfA (A:)
    qslligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrv
    sgliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalgh
    qqiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivp
    tamlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqt
    svdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlfA (A:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tlfB (B:)
    qslligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrv
    sgliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalgh
    qqiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivp
    tamlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqt
    svdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlfB (B:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tlfC (C:)
    qslligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrv
    sgliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalgh
    qqiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivp
    tamlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqt
    svdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlfC (C:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tlfD (D:)
    qslligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrv
    sgliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalgh
    qqiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivp
    tamlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqt
    svdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesg
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tlfD (D:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl