PDB entry 1tle

View 1tle on RCSB PDB site
Description: le (laminin-type egf-like) module giii4 in solution at ph 3.5 and 290 k, nmr, 14 structures
Deposited on 1996-01-26, released 1997-02-12
The last revision prior to the SCOP 1.67 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1tle__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tle_ (-)
    rpcqcndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkcka