PDB entry 1tld

View 1tld on RCSB PDB site
Description: crystal structure of bovine beta-trypsin at 1.5 angstroms resolution in a crystal form with low molecular packing density. active site geometry, ion pairs and solvent structure
Deposited on 1989-07-24, released 1990-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tld__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tld_ (-)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn