PDB entry 1tla

View 1tla on RCSB PDB site
Description: hydrophobic core repacking and aromatic-aromatic interaction in the thermostable mutant of t4 lysozyme ser 117 (right arrow) phe
Deposited on 1993-03-22, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tla__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tla_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnflrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk