PDB entry 1tl6

View 1tl6 on RCSB PDB site
Description: Solution structure of T4 bacteriphage AsiA monomer
Class: transcription
Keywords: Asia, T4 bacteriophage, TRANSCRIPTION
Deposited on 2004-06-09, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 KDA Anti-Sigma Factor
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tl6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tl6A (A:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl6A (A:)
    nknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivsel
    tqedkktlidefnegfegvyrylemytnk