PDB entry 1tl4

View 1tl4 on RCSB PDB site
Description: Solution structure of Cu(I) HAH1
Class: metal transport
Keywords: copper protein, copper chaperone, Menkes, Wilson, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL TRANSPORT
Deposited on 2004-06-09, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tl4a_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tl4A (A:)
    mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
    tvsylgle