PDB entry 1tl1

View 1tl1 on RCSB PDB site
Description:
Deposited on 2004-06-09, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1tl1a1, d1tl1a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1tl1b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tl1A (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl1A (A:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyv
    gsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpek
    dswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenrei
    lkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlt
    eavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql
    ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
    yalgiiqaqpdqseselvnqiieqlikkekvylawvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tl1B (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl1B (B:)
    tvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikst
    kwrklvdfrelnkrtqdfwphpaglkkkksvtvldvgdayfsvpldedfrkytaftipsi
    nnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsdlei
    gqhrtkieelrqhllrwglppflwmgyelhpdkwtvqpivlpekdswtvndiqklvgkln
    wasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdl
    iaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpkfk
    lpiqketwetwwteywqatwipewefvntpplvklwyqle