PDB entry 1tl0

View 1tl0 on RCSB PDB site
Description: Novel carbohydrate binding site identified in a hybrid of cholera toxin and Escherichia coli heat-labile enterotoxin B-subunits: 1.9 crystal structure reveals the details
Class: toxin
Keywords: blood group A pentasaccharide, crystal structure, protein-carbohydrate interactions, cholera toxin, heat-labile enterotoxin, water-mediated interactions
Deposited on 2004-06-09, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-02-27, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0d_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0e_
  • Chain 'F':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0f_
  • Chain 'G':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0g_
  • Chain 'H':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0h_
  • Chain 'I':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0i_
  • Chain 'J':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0j_
  • Chain 'K':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0k_
  • Chain 'L':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0l_
  • Chain 'M':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae
    Gene: ctxB, toxB
    Domains in SCOPe 2.07: d1tl0m_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tl0D (D:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0D (D:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgqkkaie
    rmkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tl0E (E:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0E (E:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpsqkkaie
    rmkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tl0F (F:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0F (F:)
    apqnitelcseyhntqiytindkilsyteslrgkemaiitfkngatfqvevdsqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tl0G (G:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0G (G:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tl0H (H:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0H (H:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpghidsqk
    kaiermkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tl0I (I:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0I (I:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpqkkaier
    mkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tl0J (J:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0J (J:)
    apqnitelcseyhntqiytindkilsyteslrgremaiitfkngatfqvevqkkaiermk
    dtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tl0K (K:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0K (K:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvekkaiermkd
    tlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tl0L (L:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0L (L:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpdsqkkai
    ermkdtlriaylteakveklcvwnnktpnsiaaisma
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1tl0M (M:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tl0M (M:)
    apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma