PDB entry 1tkz

View 1tkz on RCSB PDB site
Description: crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Class: transferase
Keywords: hiv-1 reverse transcriptase, aids, nnrti, gw429576, drug design, transferase
Deposited on 2004-06-09, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein, Reverse transcriptase, Chain A
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585
      • modified residue (279)
    Domains in SCOPe 2.08: d1tkza1, d1tkza2
  • Chain 'B':
    Compound: Pol polyprotein, Reverse transcriptase, Chain B
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tkzb1
  • Heterogens: PO4, H16

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tkzA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkzA (A:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyv
    gsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpek
    dswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenrei
    lkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlt
    eavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql
    ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
    yalgiiqaqpdqseselvnqiieqlikkekvylawvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tkzB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkzB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfwphpaglkkkksvtvldvgdayfsvpldedfrkytaft
    ipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
    dleigqhrtkieelrqhllrwglppflwmgyelhpdkwtvqpivlpekdswtvndiqklv
    gklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydp
    skdliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgkt
    pkfklpiqketwetwwteywqatwipewefvntpplvklwy