PDB entry 1tkw

View 1tkw on RCSB PDB site
Description: The transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic NMR
Class: photosynthesis
Keywords: Electron transfer, photosynthesis, NMR, paramagnetic, rigid body calculations
Deposited on 2004-06-09, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin a
  Species: Populus nigra [TaxId:3691]
  Gene: PETE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOPe 2.08: d1tkwa_
• Chain 'B':
  Compound: cytochrome f
  Species: Brassica rapa subsp. rapa [TaxId:51350]
  Gene: PETA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36438 (0-End)
• Heterogens: CU, HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tkwA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
  

  
  
• Chain 'B':
  No sequence available.