PDB entry 1tku

View 1tku on RCSB PDB site
Description: Crystal Structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans in complex with Ribulose-5-phosphate
Deposited on 2004-06-09, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.184
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tkua_
  • Chain 'B':
    Domains in SCOP 1.69: d1tkub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tkuA (A:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkuA (A:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tkuB (B:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkuB (B:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyisk