PDB entry 1tks

View 1tks on RCSB PDB site
Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans
Class: isomerase
Keywords: Candida albicans, riboflavin biosynthesis, 3,4-dihydroxy-2-butanone 4-phosphate synthase, crystal structure synthetic gene, ISOMERASE
Deposited on 2004-06-09, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Candida albicans [TaxId:237561]
    Gene: CARib3
    Database cross-references and differences (RAF-indexed):
    • GB EAK97363 (Start-203)
    Domains in SCOPe 2.08: d1tksa_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Candida albicans [TaxId:237561]
    Gene: CARib3
    Database cross-references and differences (RAF-indexed):
    • GB EAK97363 (Start-203)
    Domains in SCOPe 2.08: d1tksb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tksA (A:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tksA (A:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tksB (B:)
    mtniftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcv
    plseeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskp
    qdfikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrldd
    ciqfgkkhgikiininqlveyisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tksB (B:)
    niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
    seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
    ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
    gikiininqlveyisk