PDB entry 1tkn

View 1tkn on RCSB PDB site
Description: Solution structure of CAPPD*, an independently folded extracellular domain of human Amyloid-beta Precursor Protein
Class: membrane protein
Keywords: four alpha-helices, three-helical bundle, app, alzheimer's disease, membrane protein
Deposited on 2004-06-08, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tkna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tknA (A:)
rveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvd
pkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellqke