PDB entry 1tkn

View 1tkn on RCSB PDB site
Description: Solution structure of CAPPD*, an independently folded extracellular domain of human Amyloid-beta Precursor Protein
Deposited on 2004-06-08, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tkna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tknA (A:)
    rveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvd
    pkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellqke