SCOPe 2.07: Structural Classification of Proteins

PDB entry 1tkk

View 1tkk on RCSB PDB site
Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis
Class: isomerase
Keywords: epimerase, enolase super family,, ISOMERASE
Deposited on 2004-06-08, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkka1, d1tkka2
Chain 'B':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkb1, d1tkkb2
Chain 'C':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkc1, d1tkkc2
Chain 'D':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkd1, d1tkkd2
Chain 'E':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkke1, d1tkke2
Chain 'F':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkf1, d1tkkf2
Chain 'G':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkg1, d1tkkg2
Chain 'H':
Compound: similar to chloromuconate cycloisomerase
Species: Bacillus subtilis [TaxId:1423]
Gene: ykfB
Database cross-references and differences (RAF-indexed):
- GB NP_389181 (0-End)
Domains in SCOPe 2.07: d1tkkh1, d1tkkh2
Heterogens: MG, ALA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1tkkA (A:)
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
kgekeq