PDB entry 1tkk

View 1tkk on RCSB PDB site
Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis
Deposited on 2004-06-08, released 2004-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tkkA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkA (A:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tkkB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkB (B:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tkkC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkC (C:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tkkD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkD (D:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tkkE (E:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkE (E:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tkkF (F:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkF (F:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tkkG (G:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkG (G:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tkkH (H:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaall
    kgekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkkH (H:)
    mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
    siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
    qmlggyrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirk
    rvgsavklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtp
    imadesvftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmiet
    klgitaaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaal