PDB entry 1tke

View 1tke on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with serine
Class: ligase
Keywords: ligase
Deposited on 2004-06-08, released 2004-11-30
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.178
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli
    Gene: THRS, B1719, C2116, SF1512, S1630
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tkea1, d1tkea2
  • Heterogens: SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tkeA (A:)
    mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
    takdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveal
    ekrmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvd
    mcrgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa