PDB entry 1tke

View 1tke on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with serine
Deposited on 2004-06-08, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.178
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tkeA (A:)
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
takdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveal
ekrmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvd
mcrgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa