PDB entry 1tk9

View 1tk9 on RCSB PDB site
Description: Crystal Structure of Phosphoheptose isomerase 1
Class: isomerase
Keywords: Lipopolysaccharide biosynthesis, STRUCTURAL GENOMICS, NYSGXRC, T1512, LPC1_CAMJE, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2004-06-08, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoheptose isomerase 1
    Species: Campylobacter jejuni [TaxId:197]
    Gene: LPCA1, GMHA1, CJ1149C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PNE6 (3-187)
      • cloning artifact (0-2)
      • modified residue (137)
      • modified residue (149-150)
      • modified residue (171)
    Domains in SCOPe 2.07: d1tk9a1, d1tk9a2
  • Chain 'B':
    Compound: Phosphoheptose isomerase 1
    Species: Campylobacter jejuni [TaxId:197]
    Gene: LPCA1, GMHA1, CJ1149C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PNE6 (3-187)
      • cloning artifact (0-2)
      • modified residue (137)
      • modified residue (149-150)
      • modified residue (171)
    Domains in SCOPe 2.07: d1tk9b1, d1tk9b2
  • Chain 'C':
    Compound: Phosphoheptose isomerase 1
    Species: Campylobacter jejuni [TaxId:197]
    Gene: LPCA1, GMHA1, CJ1149C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PNE6 (3-187)
      • cloning artifact (0-2)
      • modified residue (137)
      • modified residue (149-150)
      • modified residue (171)
    Domains in SCOPe 2.07: d1tk9c1, d1tk9c2
  • Chain 'D':
    Compound: Phosphoheptose isomerase 1
    Species: Campylobacter jejuni [TaxId:197]
    Gene: LPCA1, GMHA1, CJ1149C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PNE6 (3-187)
      • cloning artifact (0-2)
      • modified residue (137)
      • modified residue (149-150)
      • modified residue (171)
    Domains in SCOPe 2.07: d1tk9d1, d1tk9d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tk9A (A:)
    mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhf
    aaelsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligists
    gkspnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtl
    cqiidesf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tk9B (B:)
    mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhf
    aaelsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligists
    gkspnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtl
    cqiidesf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tk9C (C:)
    mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhf
    aaelsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligists
    gkspnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtl
    cqiidesf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tk9D (D:)
    mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhf
    aaelsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligists
    gkspnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtl
    cqiidesf