PDB entry 1tk7

View 1tk7 on RCSB PDB site
Description: NMR structure of WW domains (WW3-4) from Suppressor of Deltex
Class: signaling protein
Keywords: WW domain, Notch, SIGNALING PROTEIN
Deposited on 2004-06-08, released 2004-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cg4244-pb
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: Su(dx)
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y0H4 (7-87)
    • cloning artifact (0-6)
  Domains in SCOPe 2.06: d1tk7a1, d1tk7a2, d1tk7a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tk7A (A:)
  gspefhmdalgplpdgwekkiqsdnrvyfvnhknrttqwedprtqgqevslinegplppg
  weirytaagerffvdhntrrttfedprp