PDB entry 1tk4

View 1tk4 on RCSB PDB site
Description: Crystal structure of russells viper phospholipase A2 in complex with a specifically designed tetrapeptide Ala-Ile-Arg-Ser at 1.1 A resolution
Class: hydrolase
Keywords: Crystal structure, tetrapeptide, phospholipase A2
Deposited on 2004-06-08, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.168
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-110)
  Domains in SCOP 1.73: d1tk4a_
• Chain 'B':
  Compound: Tetrapeptide Ala-Ile-Arg-Ser
  Species: synthetic, synthetic
  
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tk4A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  No sequence available.