PDB entry 1tk3

View 1tk3 on RCSB PDB site
Description: Crystal Structure Of Human Apo Dipeptidyl Peptidase IV/CD26
Class: hydrolase
Keywords: alpha/beta hydrolase, beta-propeller, homodimer, HYDROLASE
Deposited on 2004-06-08, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tk3a1, d1tk3a2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tk3b1, d1tk3b2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tk3A (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tk3A (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tk3B (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp