PDB entry 1tk0

View 1tk0 on RCSB PDB site
Description: t7 dna polymerase ternary complex with 8 oxo guanosine and ddctp at the insertion site
Deposited on 2004-06-07, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tk0A (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tk0A (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpegrep
    celdtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegv
    rvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngavtgrath
    afpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclahfmarfd
    ngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagkergkelk
    kkflentpaiaalresiqqtlvessqqvkwkrrwikgldgrkvhvrsphaalntllqsag
    alicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamr
    wvgdhwnfrclldtegkmgpnwaich
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tk0B (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tk0B (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl