PDB entry 1tjy

View 1tjy on RCSB PDB site
Description: crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf
Deposited on 2004-06-07, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tjya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjyA (A:)
    gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg
    ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema
    ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta
    egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg
    lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll
    pervifnkdnidkydf