PDB entry 1tjx

View 1tjx on RCSB PDB site
Description: Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain
Class: endocytosis/exocytosis
Keywords: Synaptotagmin I, C2B domain, Calcium binding
Deposited on 2004-06-07, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.167
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to synaptotagminI/p65
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21707 (8-End)
      • cloning artifact (0-7)
    Domains in SCOP 1.73: d1tjxa_
  • Heterogens: CA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tjxA (A:)
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk

    Sequence, based on observed residues (ATOM records): (download) 
    >1tjxA (A:)
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav