PDB entry 1tjw

View 1tjw on RCSB PDB site
Description: Crystal Structure of T161D Duck Delta 2 Crystallin Mutant with bound argininosuccinate
Class: lyase
Keywords: eye lens protein, delta 2 crystallin, argininosuccinate lyase, enzyme mechanism
Deposited on 2004-06-07, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (160)
    Domains in SCOPe 2.07: d1tjwa_
  • Chain 'B':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (160)
    Domains in SCOPe 2.07: d1tjwb_
  • Chain 'C':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058 (Start-467)
      • engineered (160)
    Domains in SCOPe 2.07: d1tjwc_
  • Chain 'D':
    Compound: delta crystallin II
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058
      • engineered (160)
    Domains in SCOPe 2.07: d1tjwd_
  • Heterogens: AS1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjwA (A:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjwA (A:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjwB (B:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjwB (B:)
    dpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewskg
    vfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthll
    qliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinvl
    plgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskma
    edliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkgl
    pstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalyl
    vrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveqy
    talagtakssvttqieqlrelmkkqkeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tjwC (C:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjwC (C:)
    dpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewskg
    vfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthll
    qliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinvl
    plgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskma
    edliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkgl
    pstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalyl
    vrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveqy
    talagtakssvttqieqlrelmkkqkeqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tjwD (D:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjwD (D:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeq