PDB entry 1tjv

View 1tjv on RCSB PDB site
Description: Crystal Structure of T161D Duck Delta 2 Crystallin Mutant
Deposited on 2004-06-07, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tjva_
  • Chain 'B':
    Domains in SCOP 1.71: d1tjvb_
  • Chain 'C':
    Domains in SCOP 1.71: d1tjvc_
  • Chain 'D':
    Domains in SCOP 1.71: d1tjvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjvA (A:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjvA (A:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjvB (B:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjvB (B:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tjvC (C:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjvC (C:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tjvD (D:)
    maseargdklwggrfsgstdpimeklnssiaydqrlsevdiqgsmayakalekagiltkt
    elekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvv
    tdlklfmknslsiisthllqliktlveraaieidvilpgydhlqkaqpirwsqfllshav
    altrdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdf
    vveflsfatllmihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirs
    kagrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqvatgvistlqiske
    nmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgitinklsledlksisp
    qfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjvD (D:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqkeqa