PDB entry 1tjn

View 1tjn on RCSB PDB site
Description: Crystal structure of hypothetical protein af0721 from Archaeoglobus fulgidus
Class: lyase
Keywords: af0721, APC5049, Midwest Consortium for Structural Genomics, Protein Structure Initiative, A. fulgidus, structural genomics, PSI, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2004-06-06, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sirohydrochlorin cobaltochelatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: CBIX, AF0721
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tjna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjnA (A:)
    mgsshhhhhhssgrenlyfqghmrrglvivghgsqlnhyrevmelhrkrieesgafdevk
    iafaarkrrpmpdeairemncdiiyvvplfisyglhvtedlpdllgfprgrgikegefeg
    kkvvicepigedyfvtyailnsvfrigrdgkgeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjnA (A:)
    mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
    iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
    vfrig