PDB entry 1tjm

View 1tjm on RCSB PDB site
Description: Crystallographic Identification of Sr2+ Coordination Site in Synaptotagmin I C2B Domain
Deposited on 2004-06-06, released 2004-09-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.159
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tjma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjmA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjmA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav